Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For BBYUK1708-12     Back to Search: Records
  IDENTIFIERS:
  Sample ID: CCDB-18336-D12 Museum ID: BABY-8006
  Field ID: 11-0447 Collection Code:
  Deposited In: Research Collection of B. A. Bennett
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Magnoliophyta Subfamily:
  Class: Magnoliopsida Genus: Populus
  Order: Malpighiales Species: Populus deltoides
  Family: Salicaceae Subspecies:
  BIN (Cluster ID):
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction:
  Tissue Descriptor: Sex:
  Brief Note: Life Stage:
  Detailed Notes:
 
  COLLECTION DATA:
  Country: Canada Date Collected: 2011-08-24
  Province/State: Saskatchewan Collectors:
  Region/County:    
  Sector:    
  Exact Site: Saskatoon, Kiwanis Park, South Saskatchewan River    
  Latitude: 52.126 Elevation: 475 Meters
  Longitude: -106.657 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: rbcLa   [Funding Source: iBOL:WG1.2]
  Sequence ID: BBYUK1708-12.rbcLa GenBank Accession:
  Last Updated: 2017-05-22 Genome: Chloroplast
  Locus:
  Nucleotides: 552 bp
 
GGTGTTGGATTCAAGGCTGGTGTTAAAGATTATAAATTGACTTATTATACTCCTGAGTATGAAACCAAAGATACT
GATATCTTGGCAGCATTCCGAGTAACTCCTCAACCTGGAGTTCCGCCCGAGGAAGCAGGGGCCGCAGTAGCTGCT
GAATCTTCTACTGGTACATGGACAACTGTGTGGACCGACGGGCTTACCAGTCTTGATCGTTATAAGGGACGATGC
TACGACATCGAGCCCGTTGCTGGAGAAGAAAATCAATTTATTGCTTATGTAGCTTACCCCTTAGACCTTTTTGAA
GAAGGTTCCGTTACTAACATGTTTACTTCCATTGTGGGTAATGTATTTGGGTTCAAAGCCCTACGCGCTCTACGT
CTGGAGGATTTGCGAATTCCTCCTGCTTATGTTAAAACTTTTCAAGGCCCACCTCATGGTATCCAAGTTGAAAGA
GATAAATTGAACAAGTATGGTCGCCCCCTATTGGGCTGTACTATTAAACCTAAATTGGGGTTATCCGCTAAGAAT
TACGGTAGAGCAGTTTATGAATGTCTA
  Amino Acids:  
 
GVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRC
YDIEPVAGEENQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVER
DKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: rbcLa
  Length Pcr Primers Seq Primer Read Status Run Date  
512 rbcLa-F / rbcLa-R
rbcLa-F
Forward high qual 2012-07-31  
519 rbcLa-F / rbcLa-R
rbcLa-R
Reverse high qual 2012-07-31  
 
  ELECTROPHEROGRAM TRACE FILES: ITS2
  Length Pcr Primers Seq Primer Read Status Run Date  
377 ITS_S2F / ITS_S3R
ITS_S2F
Forward med qual 2012-08-22  
375 ITS_S2F / ITS_S3R
ITS_S3R
Reverse med qual 2012-08-22  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Non-Commercial Share-Alike (2012)
  License Holder:
Biodiversity Institute of ontario, Unspecified

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Research Collection of B. A. Bennett
Sequencing Center:
Photography: Masha Kuzmina
Collectors:
Specimen Identification: Bruce A. Bennett
Project Manager: Masha L. Kuzmina
Sequencing Support: International Barcode of Life (WG1.2)