Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For CYTC5398-12     Back to Search: Records
  IDENTIFIERS:
  Sample ID: JQ437479 Museum ID:
  Field ID: JQ437479 Collection Code:
  Deposited In: Mined from GenBank, NCBI
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Chordata Subfamily: Bovinae
  Class: Mammalia Genus: Bos
  Order: Artiodactyla Species: Bos primigenius
  Family: Bovidae Subspecies:
  BIN (Cluster ID): BOLD:AAA2294
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction:
  Tissue Descriptor: Sex:
  Brief Note: Life Stage:
  Detailed Notes: Bos primigenius
 
  COLLECTION DATA:
  Country: Date Collected:
  Province/State: Collectors:
  Region/County:    
  Sector:    
  Exact Site:    
  Latitude: Elevation:
  Longitude: Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COII   [Funding Source: N/A]
  Sequence ID: CYTC5398-12.COII GenBank Accession:
  Last Updated: 2017-06-19 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 2
  Nucleotides: 676 bp
 
ATGGCATATCCCATACAACTAGGATTCCAAGATGCAACATCACCAATCATAGAAGAACTACTTCACTTTCATGAC
CACACGCTAATAATTGTCTTCTTAATTAGCTCATTAGTACTTTACATTATTTCACTAATACTAACGACAAAGCTG
ACCCATACAAGCACGATAGATGCACAAGAAGTAGAGACAATCTGAACCATTCTGCCCGCCATCATCTTAATTCTA
ATTGCTCTTCCTTCTTTACGAATTCTATACATAATAGATGAAATCAATAACCCATCTCTTACAGTAAAAACCATA
GGACATCAGTGATACTGAAGCTATGAGTATACAGATTATGAGGACTTAAGCTTCGACTCCTACATAATTCCAACA
TCAGAATTAAAGCCAGGGGAGCTACGACTATTAGAAGTCGATAATCGAGTTGTACTACCAATAGAAATAACAATC
CGAATGTTAGTCTCCTCTGAAGACGTATTACACTCATGAGCTGTGCCCTCTCTAGGACTAAAAACAGACGCAATC
CCAGGCCGTCTAAACCAAACAACCCTTATATCGTCCCGTCCAGGCTTATATTATGGTCAATGCTCAGAAATTTGC
GGGTCAAACCACAGTTTCATGCCCATTGTCCTTGAGTTAGTCCCACTAAAGTACTTTGAAAAATGATCTGCGTCA
A
  Amino Acids:  
 
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILIL
IALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTI
RMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSAS
X
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

  SEQUENCE: atp6   [Funding Source: N/A]
  Sequence ID: CYTC5398-12.atp6 GenBank Accession:
  Last Updated: 2017-06-19 Genome: Mitochondrial
  Locus: ATP synthase subunit 6
  Nucleotides: 678 bp
 
ATGAACGAAAATTTATTTACCTCTTTTATTACCCCTGTAATTTTAGGTCTCCCTCTCGTAACCCTTATTGTACTA
TTCCCCAGCCTACTATTCCCAACATCAAACCGACTAGTAAGCAATCGCTTTGTAACCCTCCAACAATGAATACTT
CAACTTGTATCAAAACAAATAATGAGTATCCACAATTCTAAAGGACAAACATGAACATTAATATTAATATCTCTG
ATCCTATTTATTGGATCAACAAACCTACTAGGCCTATTACCCCATTCATTCACACCAACAACACAACTATCAATA
AACCTAGGCATAGCCATCCCCCTGTGAGCAGGAGCCGTAATTACAGGATTCCGCAATAAAACTAAAGCATCACTT
GCCCATTTCTTACCACAAGGAACACCCACTCCACTAATCCCAATACTAGTAATTATTGAAACTATCAGCCTTTTT
ATTCAACCTATAGCCCTCGCCGTGCGGTTAACAGCTAACATCACTGCAGGACACCTATTAATTCACCTAATCGGA
GGAGCTACACTTGCACTAATAAGCATTAGCACTACAACAGCTCTAATTACATTCACCATTCTAATCCTACTAACA
ATTCTAGAGTTTGCAGTAGCTATAATCCAAGCCTATGTATTCACTCTCCTAGTCAGCCTATATCTGCATGACAAC
ACA
  Amino Acids:  
 
MNENLFTSFITPVILGLPLVTLIVLFPSLLFPTSNRLVSNRFVTLQQWMLQLVSKQMMSIHNSKGQTWTLMLMSL
ILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGAVITGFRNKTKASLAHFLPQGTPTPLIPMLVIIETISLF
IQPMALAVRLTANITAGHLLIHLIGGATLALMSISTTTALITFTILILLTILEFAVAMIQAYVFTLLVSLYLHDN
T
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

  SEQUENCE: COXIII   [Funding Source: N/A]
  Sequence ID: CYTC5398-12.COXIII GenBank Accession:
  Last Updated: 2017-06-19 Genome: Mitochondrial
  Locus: cytochrome c oxidase subunit III
  Nucleotides: 781 bp
 
ATGACACACCAAACTCATGCTTATCATATAGTAAACCCAAGCCCTTGACCTCTTACAGGAGCTTTGTCTGCCCTC
TTAATAACATCCGGCCTAACCATGTGATTTCACTTTAACTCAATGACCCTGCTAATAATTGGCCTAACAACAAAT
ATACTAACAATATACCAATGATGACGAGATGTTATCCGAGAAAGCACCTTCCAAGGGCACCATACCCCAGCTGTC
CAAAAAGGCCTCCGTTATGGAATAATTCTTTTTATTATCTCCGAAGTACTATTCTTTACCGGATTTTTCTGAGCT
TTCTACCACTCAAGCCTCGCCCCCACCCCTGAACTAGGCGGCTGCTGACCCCCAACAGGCATTCACCCACTAAAC
CCCCTAGAAGTCCCACTGCTCAACACCTCTGTCCTATTGGCTTCCGGAGTTTCTATTACCTGAGCCCATCATAGT
TTAATAGAAGGGGACCGAAAGCATATATTACAAGCCCTATTTATCACCATCACATTAGGAGTCTACTTCACACTA
CTACAAGCCTCAGAATACTATGAAGCACCTTTTACTATCTCCGACGGAGTTTACGGCTCAACTTTTTTTGTAGCC
ACAGGCTTCCACGGCCTCCACGTCATCATTGGGTCCACCTTCTTAATTGTCTGCTTCTTCCGCCAATTAAAATTT
CATTTTACTTCTAACCACCACTTCGGCTTTGAAGCCGCTGCCTGATACTGACATTTCGTAGACGTAGTCTGACTT
TTCCTCTATGTTTCTATCTATTGATGAGGCT
  Amino Acids:  
 
MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAV
QKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHS
LMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKF
HFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGX
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

  SEQUENCE: CYTB   [Funding Source: N/A]
  Sequence ID: CYTC5398-12.CYTB GenBank Accession:
  Last Updated: 2017-06-19 Genome: Mitochondrial
  Locus:
  Nucleotides: 1137 bp
 
ATGACTAACATTCGAAAGTCCCACCCACTAATAAAAATTGTAAACAATGCATTCATCGACCTTCCAGCCCCATCA
AACATTTCATCATGATGAAATTTCGGTTCCCTCCTGGGAATCTGCCTAATCCTACAAATCCTCACAGGCCTATTC
CTAGCAATACACTACACATCCGACACAACAACAGCATTCTCCTCTGTTACCCATATCTGCCGAGACGTGAACTAC
GGCTGAATCATCCGATACATACACGCAAACGGAGCTTCAATGTTTTTTATCTGCTTATATATGCACGTAGGACGA
GGCTTATATTACGGGTCTTACACTTTTCTAGAAACATGAAATATTGGAGTAATCCTTCTACTCACAGTAATAGCC
ACAGCATTTATAGGATACGTCCTACCATGAGGACAAATATCATTCTGAGGAGCAACAGTCATCACCAACCTCTTA
TCAGCAATCCCATACATCGGCACAAATTTAGTCGAATGAATCTGAGGCGGATTCTCAGTAGACAAAGCAACCCTT
ACCCGATTCTTCGCTTTCCATTTTATCCTTCCATTTATCATCATAGCAATTGCCATAGTCCACCTACTATTCCTC
CACGAAACAGGCTCCAACAATCCAACAGGAATTTCCTCAGACGTAGACAAAATCCCATTCCACCCCTACTATACC
ATTAAGGACATCTTAGGGGCCCTCTTACTAATTCTAGCTCTAATACTACTAGTACTATTCGCACCCGACCTCCTC
GGAGACCCAGATAACTACACCCCAGCCAATCCACTCAACACACCCCCTCACATCAAACCCGAGTGATACTTCTTA
TTTGCATACGCAATCTTACGATCAATCCCCAACAAACTAGGAGGAGTACTAGCCCTAGCCTTCTCTATCCTAATT
CTTGCTCTAATCCCCCTACTACACACCTCCAAACAACGAAGCATAATATTCCGACCATTCAGCCAATGCCTATTC
TGAGCCCTAGTAGCAGACCTACTGACACTCACATGAATTGGAGGACAACCAGTCGAACACCCATATATCACCATC
GGACAACTAGCATCTGTCCTATACTTTCTCCTCATCCTAGTGCTAATACCAACGGCCGGCACAGTCGAAAACAAA
TTACTAAAATGA
  Amino Acids:  
 
MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNY
GWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLL
SAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYT
IKDILGALLLILALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILI
LALIPLLHTSKQRSMMFRPFSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTVENK
LLKW
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: CYTC5398-12.COI-5P GenBank Accession: JQ437479
  Last Updated: 2017-06-19 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 1000 bp
 
ATGTTCATTAACCGCTGACTATTCTCAACCAACCATAAAGATATTGGTACCCTTTACCTACTATTTGGTGCTTGG
GCCGGTATAGTAGGAACAGCTCTAAGCCTTCTAATTCGCGCTGAATTAGGCCAACCCGGAACTCTGCTCGGAGAC
GACCAAATCTACAACGTAGTTGTAACCGCACACGCATTTGTAATAATCTTCTTTATAGTAATGCCAATCATAATT
GGAGGATTCGGTAACTGACTTGTTCCCCTAATAATTGGTGCTCCCGATATAGCATTTCCCCGAATAAATAATATA
AGCTTCTGACTCCTCCCTCCCTCATTCCTACTACTCCTCGCATCCTCTATAGTTGAAGCTGGGGCAGGAACAGGC
TGAACCGTGTACCCTCCCTTAGCAGGCAACCTAGCCCATGCAGGAGCTTCAGTAGATCTAACCATTTTCTCTTTA
CACTTAGCAGGAGTTTCCTCAATCTTAGGAGCCATCAACTTCATTACAACAATTATCAACATAAAGCCCCCCGCA
ATGTCACAATACCAAACCCCTCTGTTCGTATGATCCGTAATAATTACCGCCGTACTACTACTACTCTCGCTCCCT
GTATTAGCAGCCGGCATCACAATGCTATTAACAGACCGGAACCTAAATACAACCTTCTTCGACCCGGCAGGAGGA
GGAGACCCTATTCTATATCAACACTTATTCTGATTCTTTGGACACCCCGAAGTCTATATTTTAATCTTACCTGGA
TTTGGAATAATCTCCCATATCGTGACCTACTACTCAGGAAAAAAAGAACCATTCGGATATATGGGAATAGTTTGG
GCTATAATGTCAATCGGATTTCTAGGTTTCATCGTATGAGCCCACCATATATTCACTGTCGGAATAGACGTCGAC
ACACGAGCCTACTTCACATCAGCCACTATAATTATTGCTATTCCAACCGGGGTAAAAGTCTTCAGCTGATTGGCA
ACACTTCATGGAGGTAATATCAAAT
  Amino Acids:  
 
MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMI
GGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSL
HLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGG
GDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKX
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
Generated using the BOLD API

													
  Specimen Images: N/A
Collection Site: N/A
  Attribution:
Specimen Depository: Mined from GenBank, NCBI
Sequencing Center:
Photography:
Collectors:
Specimen Identification:
Project Manager: Sujeevan Ratnasingham
Sequencing Support: