Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For LBCH3416-10     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 10-JDWBC-3416 Museum ID:
  Field ID: 10-JDWBC-3416 Collection Code:
  Deposited In: Research Collection of Jeremy deWaard
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Batrachedrinae
  Class: Insecta Genus: Batrachedra
  Order: Lepidoptera Species: Batrachedra praeangusta
  Family: Batrachedridae Subspecies:
  BIN (Cluster ID): BOLD:AAC6252
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction:
  Tissue Descriptor: Sex:
  Brief Note: A3-T Life Stage:
  Detailed Notes: UV trap
 
  COLLECTION DATA:
  Country: Canada Date Collected: 2009-07-30
  Province/State: British Columbia Collectors: deWaard, J.R.
  Region/County: nr. Hazelton    
  Sector: Date Cr. Silvicultural System    
  Exact Site: A3-T    
  Latitude: 55.464 Elevation: 426 Meters
  Longitude: -127.81 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: iBOL:WG1.9]
  Sequence ID: LBCH3416-10.COI-5P GenBank Accession: HM865276
  Last Updated: 2017-06-19 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 658 bp
 
AACATTATATTTCATTTTTGGAATTTGGGCAGGTATAGTAGGAACTTCTTTAAGTTTATTAATTCGAGCTGAATT
AGGAAATCCAGGATCATTAATTGGTGATGACCAAATTTATAATACTATTGTCACAGCCCATGCTTTTATTATAAT
TTTTTTTATAGTAATACCAATTATAATTGGAGGATTTGGAAATTGATTAGTCCCTTTAATATTAGGAGCCCCAGA
TATAGCTTTCCCCCGAATAAATAATATAAGATTTTGATTACTCCCCCCTTCCTTAACACTTTTAATTTCCAGAAG
AATTGTAGAAAACGGAGCTGGAACAGGTTGAACAGTCTACCCCCCTTTATCTTCTAATATTGCACATAGAGGAAG
ATCAGTAGACTTAGCAATTTTCTCCTTACACCTAGCAGGGATTTCATCAATTTTAGGAGCAATTAATTTTATTAC
AACAATTATTAATATACGATTAAGAAATTTATCTTTTGATCAACTACCTTTATTTGTCTGATCAGTTGGAATTAC
AGCTTTACTTTTACTTTTATCTTTACCCGTTTTAGCCGGAGCAATTACAATACTTTTAACAGATCGAAATTTAAA
TACTTCTTTTTTTGACCCTGCTGGAGGGGGAGATCCTATTTTATATCAACATTTATTT
  Amino Acids:  
 
TLYFIFGIWAGMVGTSLSLLIRAELGNPGSLIGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPD
MAFPRMNNMSFWLLPPSLTLLISSSIVENGAGTGWTVYPPLSSNIAHSGSSVDLAIFSLHLAGISSILGAINFIT
TIINMRLSNLSFDQLPLFVWSVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
638 LepF1 / LepR1
LepF1
Forward high qual 2010-05-17  
623 LepF1 / LepR1
LepR1
Reverse high qual 2010-05-17  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution (2010)
  License Holder:
Jeremy deWaard, University of British Columbia

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution (2010)
  License Holder:
Jeremy deWaard, University of British Columbia

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Research Collection of Jeremy deWaard
Sequencing Center:
Photography: Jeremy deWaard, University of British Columbia
Collectors: deWaard, J.R.
Specimen Identification:
Project Manager: Jeremy deWaard
Sequencing Support: International Barcode of Life (WG1.9)