Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For MBFA646-07     Back to Search: Records
  IDENTIFIERS:
  Sample ID: MBIO1045.4 Museum ID: MNHN_2008-845
  Field ID: MBIO1045.4 Collection Code:
  Deposited In: Museum National d'Histoire Naturelle, Paris
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Chordata Subfamily: Scorpaeninae
  Class: Actinopterygii Genus: Sebastapistes
  Order: Scorpaeniformes Species: Sebastapistes fowleri
  Family: Scorpaenidae Subspecies:
  BIN (Cluster ID): BOLD:AAD2777
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction:
  Tissue Descriptor: Sex:
  Brief Note: FAO-77 Life Stage:
  Detailed Notes:
 
  COLLECTION DATA:
  Country: French Polynesia Date Collected: 2006-03-18
  Province/State: Collectors: Romain Causse, Julien Grignon, Matthias Vignon, Vanessa Messmer, Serge Planes, Jeffrey T. Williams
  Region/County: Society Islands    
  Sector: Moorea    
  Exact Site:    
  Latitude: -17.483 Elevation:
  Longitude: -149.9 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
  PUBLICATIONS:
  Nicolas Hubert, Christopher P. Meyer, Henrich J. Bruggemann, Fabien Guérin, Roberto J. L. Komeno, Benoit Espiau, Romain Causse, Jeffrey T. Williams and Serge Planes Cryptic Diversity in Indo-Pacific Coral-Reef Fishes Revealed by DNA-Barcoding Provides New Support to the Centre-of-Overlap Hypothesis PLoS ONE 2011-08-10;7(3):e28987 (PDF)
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: MBFA646-07.COI-5P GenBank Accession: JQ432143
  Last Updated: 2017-04-24 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 654 bp
 
ACCCTTTATTTAGTATTTGGCGCCTGAGCTGGAATAGTCGGGACTGCCCTGAGCCTCCTTATCCGAGCAGAGCTT
AGCCAACCAGGCGCACTGCTAGGGGATGACCAGATCTATAATGTAATTGTTACAGCCCACGCCTTCGTAATAATC
TTTTTTATAGTTATGCCCATCATGATTGGCGGTTTTGGAAACTGACTCATTCCCCTTATAATCGGAGCCCCCGAC
ATAGCATTCCCTCGAATGAACAACATGAGCTTTTGGCTTCTCCCACCATCCTTTCTTCTTCTGCTTGCCTCATCA
GGCGTAGAAGCTGGAGCAGGGACGGGATGAACAGTTTACCCCCCGCTAGCCGGGAATTTGGCCCATGCAGGAGCT
TCCGTCGACTTAACAATCTTTTCGTTACACCTTGCAGGGATCTCTTCGATCCTAGGAGCTATTAATTTTATCACA
ACAATTATTAATATAAAACCCCCTGCTATTTCGCAATATCAGACACCTCTATTTGTGTGGGCTGTTCTAATTACC
GCGGTTCTTCTGTTATTGTCCCTTCCCGTTCTTGCTGCTGGGATCACGATGCTCCTGACAGATCGTAATCTAAAT
ACCACATTTTTTGACCCCGCAGGCGGAGGTGACCCAATTCTTTATCAACACTTA
  Amino Acids:  
 
TLYLVFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLIPLMIGAPD
MAFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGISSILGAINFIT
TIINMKPPAISQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHL
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
582 Fish-BCL / Fish-BCH
Fish-BCH
Reverse high qual 2006-06-26  
590 Fish-BCL / Fish-BCH
Fish-BCL
Forward high qual 2006-06-26  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
Unspecified (default): All Rights Reserved 
  License Holder:
Unspecified

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Museum National d'Histoire Naturelle, Paris
Sequencing Center:
Photography:
Collectors: Romain Causse, Julien Grignon, Matthias Vignon, Vanessa Messmer, Serge Planes, Jeffrey T. Williams
Specimen Identification: Jeff Williams
Project Manager: Christopher Meyer
Sequencing Support: