Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SMTPB1143-13     Back to Search: Records
  IDENTIFIERS:
  Sample ID: BIOUG05513-A03 Museum ID: BIOUG05513-A03
  Field ID: GMP#00802 Collection Code:
  Deposited In: University of Guelph, Centre for Biodiversity Genomics
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily:
  Class: Insecta Genus: Cucujus
  Order: Coleoptera Species: Cucujus clavipes
  Family: Cucujidae Subspecies:
  BIN (Cluster ID): BOLD:ABA6312
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Vouchered:Registered Collection Reproduction:
  Tissue Descriptor: Sex:
  Brief Note: Guelph, Wellington Hall Academy Life Stage:
  Detailed Notes: Malaise 22-Apr-13 to 03-May-13
 
  COLLECTION DATA:
  Country: Canada Date Collected: 2013-05-03
  Province/State: Ontario Collectors: Catherine Huntley
  Region/County: Guelph    
  Sector: Wellington Hall Academy    
  Exact Site: EQP-CLL-550    
  Latitude: 43.5701 Elevation:
  Longitude: -80.284 Elv. Accuracy:
  Coord. Source: Google Earth Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: iBOL:WG1.6]
  Sequence ID: SMTPB1143-13.COI-5P GenBank Accession: KR481081
  Last Updated: 2017-06-19 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 658 bp
 
CACTTTATATTTTATTTTTGGAGCTTGAGCCGGAATGGTAGGAACTTCAATAAGAATACTAATTCGGTCTGAACT
TGGTACCCCTGGATCTTTAATTGGAGATGACCAAATTTACAATGTAATTGTCACAGCTCATGCTTTTATTATAAT
TTTTTTTATAGTTATACCAATCATAATTGGGGGATTTGGTAATTGATTAGTCCCTTTAATACTAGGAGCTCCAGA
TATAGCTTTCCCTCGGATAAATAATATAAGATTCTGACTTTTACCCCCCTCTCTTTCCCTACTCTTAATAAGAAG
AATTGTAGAAAAAGGGGCGGGAACAGGATGAACAGTTTATCCCCCTCTTTCCTCTAATATAGCTCACGGAGGAGC
ATCAGTTGATCTCGCAATTTTTAGACTTCATTTAGCAGGAATTTCTTCAATTCTAGGGGCAGTAAATTTTATTAC
TACAGTAATTAATATACGACCAATAGGAATAAATTTAGACCAGATACCCCTATTTGTATGAGCAGTTGTAATTAC
AGCAGTTCTCCTTCTTCTATCTCTTCCTGTATTAGCTGGAGCAATTACAATATTATTAACAGATCGAAACTTAAA
TACATCTTTCTTTGACCCGGCTGGAGGAGGAGATCCAATTTTATACCAACACTTATTT
  Amino Acids:  
 
TLYFIFGAWAGMVGTSMSMLIRSELGTPGSLIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPD
MAFPRMNNMSFWLLPPSLSLLLMSSIVEKGAGTGWTVYPPLSSNMAHGGASVDLAIFSLHLAGISSILGAVNFIT
TVINMRPMGMNLDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
630 C_LepFolF / C_LepFolR
C_LepFolR
Reverse high qual 2013-05-06  
631 C_LepFolF / C_LepFolR
C_LepFolF
Forward high qual 2014-06-21  
628 C_LepFolF / C_LepFolR
C_LepFolR
Reverse high qual 2014-06-21  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Non-Commercial Share-Alike (2012)
  License Holder:
CBG Photography Group, Centre for Biodiversity Genomics

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of Guelph, Centre for Biodiversity Genomics
Sequencing Center:
Photography: , Centre for Biodiversity Genomics
Collectors: Catherine Huntley
Specimen Identification: BOLD ID Engine
Project Manager: CBG Collections Unit
Sequencing Support: International Barcode of Life (WG1.6)