Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SMTPD4505-13     Back to Search: Records
  IDENTIFIERS:
  Sample ID: BIOUG08659-G09 Museum ID: BIOUG08659-G09
  Field ID: GMP#02148 Collection Code:
  Deposited In: University of Guelph, Centre for Biodiversity Genomics
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Galerucinae
  Class: Insecta Genus: Epitrix
  Order: Coleoptera Species: Epitrix tuberis
  Family: Chrysomelidae Subspecies:
  BIN (Cluster ID): BOLD:AAU7332
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Vouchered:Registered Collection Reproduction:
  Tissue Descriptor: Sex:
  Brief Note: Barrie, St. Mary`s School Life Stage:
  Detailed Notes: Collected from 23-Sept-13 to 27-Sept-19
 
  COLLECTION DATA:
  Country: Canada Date Collected: 2013-10-04
  Province/State: Ontario Collectors: Gerald Skillen
  Region/County: Barrie    
  Sector: St. Mary`s School    
  Exact Site: EQP-CLL-573    
  Latitude: 44.387 Elevation: 278 Meters
  Longitude: -79.719 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: iBOL:WG1.5]
  Sequence ID: SMTPD4505-13.COI-5P GenBank Accession: KR488034
  Last Updated: 2017-04-24 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 664 bp
 
AACATTATACTTTATTTTTGGAATTTGGGCTGGATTAATCGGAACTTCTTTAAGAATTCTAATCCGCACCGAATT
AGGAAA------CCCCGGAACATTAATCGGAAACGATCAAATTTATAATGTTATCGTTACTGCTCATGCTTTTAT
TATAATTTTTTTTATAGTTATACCAATTATAATTGGAGGATTTGGAAATTGACTAGTCCCCCTAATAATCGGAGC
ACCAGATATAGCTTTCCCCCGAATAAATAATATAAGATTTTGATTACTGCCCCCCTCTATTACATTATTAATTAT
AAGAAGAATAGTAGAAAGAGGAGCAGGAACAGGATGAACAGTTTACCCGCCCCTTTCTTCTAATATTGCTCATGA
AGGTTCATCAGTTGATTTAGCTATTTTTAGGCTACATCTAGCAGGAATCTCCTCTATCCTAGGAGCCATCAACTT
TATTACTACAGTAATTAACATACGACCTAATGGAATATCTTTTGACCGAATACCTTTATTTGTATGAGCAGTAGT
GATTACAGCCATTCTTCTACTACTATCATTACCGGTATTAGCCGGAGCAATTACTATACTATTAACTGATCGAAA
CTTAAATACTTCTTTTTTTGACCCCATTGGAGGGGGAGACCCAATTCTTTATCAACACTTATTT
  Amino Acids:  
 
TLYFIFGIWAGLIGTSLSILIRTELGX-XPGTLIGNDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMIGA
PDMAFPRMNNMSFWLLPPSITLLIMSSMVESGAGTGWTVYPPLSSNIAHEGSSVDLAIFSLHLAGISSILGAINF
ITTVINMRPNGMSFDRMPLFVWAVVITAILLLLSLPVLAGAITMLLTDRNLNTSFFDPIGGGDPILYQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
631 C_LepFolF / C_LepFolR
C_LepFolR
Reverse high qual 2015-03-02  
627 C_LepFolF / C_LepFolR
C_LepFolF
Forward high qual 2015-03-03  
600 C_LepFolF / C_LepFolR
C_LepFolR
Reverse high qual 2013-11-15  
 
Generated using the BOLD API

													
  Specimen Images: N/A
Collection Site:

  Attribution:
Specimen Depository: University of Guelph, Centre for Biodiversity Genomics
Sequencing Center:
Photography:
Collectors: Gerald Skillen
Specimen Identification:
Project Manager: CBG Collections Unit
Sequencing Support: International Barcode of Life (WG1.5)