Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SPLID013-13     Back to Search: Records
  IDENTIFIERS:
  Sample ID: DI13 Museum ID: UMZDI13
  Field ID: PR13 Collection Code:
  Deposited In: University of Madras
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily: Chrysomyinae
  Class: Insecta Genus: Chrysomya
  Order: Diptera Species: Chrysomya megacephala
  Family: Calliphoridae Subspecies:
  BIN (Cluster ID): BOLD:AAA5667
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Vouchered:Registered Collection Reproduction: S
  Tissue Descriptor: Sex: F
  Brief Note: Life Stage: Adult
  Detailed Notes:
 
  COLLECTION DATA:
  Country: India Date Collected: 2013-10-29
  Province/State: Tamil Nadu Collectors: P. Ramaraj
  Region/County: Chennai    
  Sector:    
  Exact Site: Royapuram Fishing harbour    
  Latitude: 13.1274 Elevation: 1.8288 Meters
  Longitude: 80.3004 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: 28S   [Funding Source: N/A]
  Sequence ID: SPLID013-13.28S GenBank Accession:
  Last Updated: 2017-05-22 Genome: Nuclear
  Locus: 28S Large Ribosomal Subunit
  Nucleotides: 496 bp
 
CCTTGTTTTGGGGGTTACTCCTTCTAAAACTAAATATAACCATGAGACCGATAGTAAACAAGTACCGTGAGGGAA
AGTTGAAAAGAACTCTGAATAGAGAGTTAAATAGTACGTGAAACTGCTTAGAGGTTAAGCCCGATGAACCTGAAT
ATCCGTTATGGAAAATTCATCATTATGATTTTAATATTTATAATATTATAATAATGGTGTGCATTTTTTCTATAA
AGGACATTGTAATCTATTAACATACAAATATTTATCATAAGATCAAGGGCGTAAGTTTATTCAAATTATTTTGCT
TGCAATTTAACATAGAATAAATGTCTTTGATTTGATAAAGTGTTGATAGATTTATTATATATAGTGCTTAAATAT
TTATATTTTATAATAGCATATTAATCATTGATTTTTATGTTTATTATATGCACTTATATGATTAACAATGCGAAA
GATTCAGGATACCTTCGGGACCCGTCTTGAAACACGGACCAAAGAA
  Amino Acids:  
 
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

  SEQUENCE: 18S   [Funding Source: N/A]
  Sequence ID: SPLID013-13.18S GenBank Accession:
  Last Updated: 2017-05-22 Genome: Nuclear
  Locus: 18S Small Ribosomal Subunit
  Nucleotides: 1000 bp
 
AGGGGGTTTGTTTTTTGATGGGGCCTGTTCAGATTAAGCCATGCATGTCTAAGTACACACGAATTAATAGTGAAA
CCGCAAAAGGCTCATTATATCAGTTATGGTTCCTTAGATCGTTAACAGTTACTTGGATAACTGTGGTAATTCTAG
AGCTAATACATGCAATATAAACACGGACCTTTGGGACGTGTGCTTTTATTAGGCTAAAACCAAGCGATCGCAAGA
TCGTTAATATGGTTGAACTCTAGATAACTTGCAGATCGTACGGTCTAGTACCGACGACAGATCTTTCAAATGTCT
GCCCTATCAACTTTTGATGGTAGTATCTAGGACTACCATGGTTGCAACGGGTAACGGGGAATCAGGGTTCGATTC
CGGAGAGGGAGCCTGAGAAACGGCTACCACATCTAAGGAAGGCAGCAGGCGCGTAAATTACCCACTCCCAGCTCG
GGGAGGTAGTGACGAAAAATAACAATACAGGACTCATATTAGAGGCCCTGTAATTGGAATGAGTACACTTTAAAT
CCTTTAACAAGGACCTATTGGAGGGCAAGTCTGGTGCCAGCAGCCGCGGTAACTCCAGCTCCAATAGCGTATATT
AAAGTTGTTGCGGTTAAAACGTTCGTAGTTGAACTTGTGCTTCATACGGGTAGTACAACTATAATTGTAGTTTGT
ACTGTACCTTATGTATGTAAGCGTATTACCGGTGGAGTTCTTATATGTATTAAATACTTGTATTTATGCATATTC
CTCCTATTTAAACCTGCTTCAGTGCTCTTCATCGAGTGTTGTTGTGGGCCGGTACAATTACTTTGAACAAATTAG
AGTGCTTAAAGCAGGCTCCAAATGCCTGAATATTTTGTGCATGGAATAATGAAATAAGACCTCTGTTCTACTTTC
ATTGGTTTTTAGATCAAGAGGTAATGATTTAATAAAAGCAGTTGGGGGCATTAGTATTACGACGCGAGAGGTGAA
ATTCTTGGACCGTCGTAAGACTACC
  Amino Acids:  
 
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: SPLID013-13.COI-5P GenBank Accession:
  Last Updated: 2017-05-22 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 650 bp
 
ATTTTCGGAGCTTGATCCGGAATAGTAGGAACTTCATTAAGTATTTTAATTCGAGCTGAATTAGGACACCCTGGA
GCATTAATTGGAGACGACCAAATTTATAATGTAATTGTAACAGCTCACGCTTTTATTATAATTTTCTTTATAGTA
ATGCCAATTATAATTGGAGGATTTGGAAATTGACTAGTTCCTTTAATGTTAGGAGCTCCAGATATAGCTTTCCCA
CGAATAAATAATATAAGTTTCTGACTTTTACCTCCTGCATTAACTTTATTATTAGTAAGTAGTATAGTAGAAAAT
GGGGCTGGAACAGGATGAACTGTTTACCCACCTTTATCTTCTAATATTGCTCATGGAGGAGCATCAGTTGATTTA
GCTATTTTCTCTTTACACTTAGCAGGAATTTCTTCAATTTTAGGAGCTGTAAATTTTATTACAACTGTAATTAAT
ATACGATCTACAGGAATTACATTTGATCGAATACCTTTATTTGTATGATCTGTAGTTATTACTGCTCTATTATTA
TTATTATCTTTACCAGTATTAGCTGGAGCTATTACTATATTATTAACTGACCGAAATCTAAATACTTCATTCTTT
GATCCAGCAGGAGGAGGAGATCCTATTTTATATCAACATTTATTTTGATT
  Amino Acids:  
 
IFGAWSGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFP
RMNNMSFWLLPPALTLLLVSSMVENGAGTGWTVYPPLSSNIAHGGASVDLAIFSLHLAGISSILGAVNFITTVIN
MRSTGITFDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWX
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
Generated using the BOLD API

													
  Specimen Images:
  License:
Unspecified (default): All Rights Reserved (2010)
  License Holder:
veeramani, University of Madrs

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
Unspecified (default): All Rights Reserved (2014)
  License Holder:
P. Ramaraj, University of Madras

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of Madras
Sequencing Center:
Photography: veeramani, University of Madrs P. Ramaraj, University of Madras
Collectors: P. Ramaraj
Specimen Identification:
Project Manager: Janarthanan Sundaram
Sequencing Support: