Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SPRMA615-10     Back to Search: Records
  IDENTIFIERS:
  Sample ID: 10-SKBC-0615 Museum ID: ENT010-002039
  Field ID: 10-SKBC-0615 Collection Code:
  Deposited In: Royal British Columbia Museum
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily:
  Class: Arachnida Genus: Gnaphosa
  Order: Araneae Species: Gnaphosa snohomish
  Family: Gnaphosidae Subspecies:
  BIN (Cluster ID): BOLD:AAP3276
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction:
  Tissue Descriptor: Sex: M
  Brief Note: Life Stage:
  Detailed Notes: ::taxonomy:::endTaxonomy:det. RG Bennett, 2003, pitfall, broom, collection time: Apr-26-May-29-2003
 
  COLLECTION DATA:
  Country: Canada Date Collected: 2003-04-26
  Province/State: British Columbia Collectors: Bennett, Salomon, Vibert
  Region/County:    
  Sector: Victoria    
  Exact Site: Island View Beach    
  Latitude: 48.573 Elevation: 2.072 Meters
  Longitude: -123.367 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
  PUBLICATIONS:
  Gergin A. Blagoev, Jeremy R. DeWaard, Sujeevan Ratnasingham, Stephanie L. DeWaard, Liuqiong Lu, James Robertson, Angela C. Telfer, Paul D. N. Hebert Untangling taxonomy: a DNA barcode reference library for Canadian spiders Molecular Ecology Resources 2015-07-26;16(1):325-341 (PDF)
 
 

  SEQUENCE: COI-5P   [Funding Source: iBOL:WG1.9]
  Sequence ID: SPRMA615-10.COI-5P GenBank Accession: JF887090
  Last Updated: 2017-04-24 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 658 bp
 
AACTTTATATTTATTATTTGGATCTTGGGCTGCTATAGTAGGAACTGCAATAAGAGTATTGATTCGTATGGAATT
AGGACAAACAGGAAGTTTATTAGGGGATGATCATCTTTATAATGTAATTGTAACAGCTCATGCATTTGTAATAAT
TTTTTTTATAGTAATACCAATTTTAATTGGGGGATTTGGAAATTGATTAGTTCCTTTAATATTAGGGGCTCCTGA
TATAGCTTTTCCTCGAATAAATAATTTAAGATTTTGATTATTGCCCCCTTCTTTAATTTTATTATTTATTTCATC
TATAGTTGAAATAGGAGTTGGAGCGGGGTGAACTGTTTACCCCCCTTTAGCTTCAGGTTTAGGGCATCCTGGAAG
AGCAATAGATTTTGCTATTTTTTCTTTACATTTAGCAGGTGCTTCTTCTATTATAGGAGCTGTAAATTTTATTTC
TACTATTATTAATATACGCTCATTTGGAATGAGAATAGAAAAGGTTTCTTTATTTGTATGATCAGTATTGATTAC
TGCTGTTTTATTATTATTGTCTTTACCTGTTTTAGCGGGTGCTATTACTATATTATTGACAGATCGAAATTTTAA
TACTTCTTTTTTTGATCCAGCTGGAGGAGGAGATCCAATTTTATTTCAACATTTATTT
  Amino Acids:  
 
TLYLLFGSWAAMVGTAMSVLIRMELGQTGSLLGDDHLYNVIVTAHAFVMIFFMVMPILIGGFGNWLVPLMLGAPD
MAFPRMNNLSFWLLPPSLILLFISSMVEMGVGAGWTVYPPLASGLGHPGSAMDFAIFSLHLAGASSIMGAVNFIS
TIINMRSFGMSMEKVSLFVWSVLITAVLLLLSLPVLAGAITMLLTDRNFNTSFFDPAGGGDPILFQHLF
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
610 C_LepFolF / C_LepFolR
C_LepFolF
Forward high qual 2011-01-15  
618 C_LepFolF / C_LepFolR
C_LepFolR
Reverse high qual 2011-01-15  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Non-Commercial Share-Alike (2010)
  License Holder:
CBG Photography Group, Centre for Biodiversity Genomics

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: Royal British Columbia Museum
Sequencing Center:
Photography: Stephanie Kirk, Centre for Biodiversity Genomics
Collectors: Bennett, Salomon, Vibert
Specimen Identification:
Project Manager: Stephanie L. deWaard
Sequencing Support: International Barcode of Life (WG1.9)