Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For TVBAC001-15     Back to Search: Records
  IDENTIFIERS:
  Sample ID: BlBPCo104-1 Museum ID:
  Field ID: BlBPCo104-1 Collection Code:
  Deposited In: Research Collection of Adriana Uscanga
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily:
  Class: Insecta Genus:
  Order: Coleoptera Species:
  Family: Carabidae Subspecies:
  BIN (Cluster ID):
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Reproduction:
  Tissue Descriptor: Sex:
  Brief Note: Life Stage:
  Detailed Notes:
 
  COLLECTION DATA:
  Country: Mexico Date Collected: 2014-04-11
  Province/State: Michoacan Collectors:
  Region/County: Transmexican Volcanic Belt    
  Sector: Reserva de la Biosfera Mariposa Monarca    
  Exact Site: Cerro Blanco    
  Latitude: Elevation: 3264 Meters
  Longitude: Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-3P   [Funding Source: N/A]
  Sequence ID: TVBAC001-15.COI-3P GenBank Accession:
  Last Updated: 2017-07-17 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 3' Region
  Nucleotides: 775 bp
 
ATTTTGGAATCATTCAATAGAAGTTGGCATTTGATTAGAGAAAATTACTAAACGTTGAGAAGTAAATCTTTCTCA
AATAATATAAATTAATAAAAGTACTCCAATAAAAGAAATTGTTGAACCAATAGATGAGATAATATTTCATGATGT
ATATGCATCAGGATAGTCTGAATATCGTCGTGGTATACCATTTAACCCTAAAAAATGTTGAGGGAAAAATGTTAA
ATTTACTCCAATAAATATAATAATAAATTGAATTTTTAATAAACTATTATTTATACTTAATCCTGTAAATAAAGG
AAATCATTGAATAAATCCAGCTATAATTGCAAAGACTGCTCCTATAGATAATACATAGTGAAAATGAGCTACAAC
ATAATATGTATCATGAAGAATAATATCAATTGATGAATTAGCTAATACTACTCCAGTTAAACCTCCTACAGTAAA
TAAAAATACAAATCCTAAAGCTCATAATAATGAAGGACTATAAGATATTTGGGCACCATGTAATGTTGCTAATCA
AGAGAAAATTTTAATTCCAGTTGGAACTGCAATAATTATTGTTGCTGAAGTAAAATAAGCTCGAGTATCTACATC
TATACCAACGGTAAATATATGATGAGCTCATACAACAAATCCTAATAATCCAATAGCTAATATAGCATAAATTAT
TCCTAATGATCCAAAAGTTTCTTTTTTTCCTCTTTCTTGGCTAATAATATGAGAAATTATTCCAAATCCGGGTAA
AATTAAAATATAGACTTCAGGATGA
  Amino Acids:  
 
FWNHSMEVGIWLEKITKRWEVNLSQMM*INKSTPMKEIVEPMDEMMFHDVYASG*SEYRRGMPFNPKKCWGKNVK
FTPMNMMMNWIFNKLLFMLNPVNKGNHWMNPAMIAKTAPMDNT*WKWATT*YVSWSMMSIDELANTTPVKPPTVN
KNTNPKAHNNEGL*DIWAPCNVANQEKILIPVGTAMIIVAEVK*ARVSTSMPTVNMWWAHTTNPNNPMANMA*II
PNDPKVSFFPLSWLMMWEIIPNPGKIKM*TSGW
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-3P
  Length Pcr Primers Seq Primer Read Status Run Date  
735 C1-J-2183F / Stev_pat_R
Stev_pat_R
Reverse high qual 2014-10-30  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons Attribution Non-Commercial Share-Alike (2016)
  License Holder:
Adriana Uscanga, Instituto de Ecologia, UNAM

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site: N/A
  Attribution:
Specimen Depository: Research Collection of Adriana Uscanga
Sequencing Center:
Photography: Adriana Uscanga, Instituto de Ecologia, UNAM
Collectors:
Specimen Identification:
Project Manager: Adriana Uscanga
Sequencing Support: